PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.9182s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HB-other
Protein Properties Length: 965aa    MW: 106593 Da    PI: 8.8711
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.9182s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox18.14.8e-0666122157
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          +r+R  ++++ ++ L+++F+ +  +s++e +e+++  g+t +qV+ +F  ++++ +k
  Araha.9182s0008.1.p  66 KRPRDLLNPKAVKYLQAVFAIKDAISKRESREISALFGITVAQVREFFVTQKTRVRK 122
                          799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.57263123IPR001356Homeobox domain
SMARTSM003895.9E-565127IPR001356Homeobox domain
SuperFamilySSF466897.27E-666128IPR009057Homeodomain-like
CDDcd000868.42E-466123No hitNo description
Gene3DG3DSA:1.10.10.607.6E-566125IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.101.9E-5228323IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476764.97E-6231324IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 965 aa     Download sequence    Send to blast
MDAFKEEIEI GSSVESLMEL LDSQKVLFHS QIDQLQDVVV TQCKLTGVNP LAQEMAAGAL  60
SIKIGKRPRD LLNPKAVKYL QAVFAIKDAI SKRESREISA LFGITVAQVR EFFVTQKTRV  120
RKQVRLSREK VIMSNTHALQ EDGVLENSNA TNHVDPVPLN STHPEACSIS WGEGETVAFM  180
PPEDIPPDIS DSDKYFVENI FSLLRKEETF SGQVKLMEWI MQIQDASVLI WFLSKGGVLI  240
LTTWLSQAAS EEQTSVLLLI LKVLCHLPLH KASPENMSAI LQSVNGLRFY RTSDISNRAK  300
GLLSRWTKLF AKIQAMKKQN RNSSQIDSQS QLLLKQSIAE IMGDSSNPED ILSLSNGRSE  360
NVRRFESSQG PKLLLTSADD STKKQMLGSN PSYNKERRKV QMVEQPGQKA AGKSPQTVRI  420
GTSGRSRPMS ADDIQKAKMR ALYMQSKNSK KDPLPSAIGD SRTVVPEKPL ALQSAKDSLP  480
SQNNEARSED TPVLSAVQPV DEPLAGQAVN GTLAGQPVNG PWAVQPVNGP WAVQPVNGPS  540
GGQPVNGPSA VIVPVQADEI KKPSTPPKSI SSKVGVMMKM SSQTIFKNCK RKQIDWHVPL  600
GMELDELWRV AAGGNSKEAD VQRNRNRRER ETLYQSLQTI PLNPKEPWDR EMDYDDSLTP  660
EIPSQQPPEE SLTEPQDSLD ERRTAAGAAT TSSSLSSPEP DLELLAALLK NPDLVYALTS  720
GKPSNLAGQD MIKLLDVIKT GAPHSSSSSN KQVEERVEVS LPSPTPSTNP GMSGWGQEGI  780
RNPFSRQNQV GAAVARSGAQ LRVASMQWHQ TNEQSIPRHA PSAYSNSITL AHTEREQQQY  840
MQPKLNHNLR LQQQEPISTT SYAVREPVGQ MGTATSGLWR SQQSQNSYYS HQENEIASAS  900
QVSSYQGNNQ YMSSSNPGYE SWSPDNSPSR NHPNMRGQQQ QQQAASRKHD SSTHPYWNQN  960
KRWR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002872830.10.0hypothetical protein ARALYDRAFT_911958
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLD7M3G50.0D7M3G5_ARALL; Putative uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein